PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010937202.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 360aa    MW: 40124.2 Da    PI: 6.3272
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010937202.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.68.2e-56171431129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL kkv + ++++ ++i evd++k+ePw+Lp ++k +e+ewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ 
  XP_010937202.1  17 LPPGFRFHPTDEELITHYLSKKVMDVSFNA-RAIGEVDLNKWEPWELPWRAKMGENEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYR- 109
                     79***************************9.89***************888999****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +++lvg+kktLvfy+grapkgek++Wvmheyrle
  XP_010937202.1 110 GKSLVGMKKTLVFYRGRAPKGEKSNWVMHEYRLE 143
                     999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-6313167IPR003441NAC domain
PROSITE profilePS5100559.69317167IPR003441NAC domain
PfamPF023653.3E-2918142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MEHGAVVPQE GEENMDLPPG FRFHPTDEEL ITHYLSKKVM DVSFNARAIG EVDLNKWEPW  60
ELPWRAKMGE NEWYFFCVRD RKYPTGLRTN RATEAGYWKA TGKDKEIYRG KSLVGMKKTL  120
VFYRGRAPKG EKSNWVMHEY RLEGKYSVYN LPKTAKNEWV ICRVFQKTSS GKKAMGLVRV  180
GSSFGEELDS SLLPPLMEAP FTSENKTSSA SDLAHVTCFS NSVEGPKVHE ELLAEYLNSP  240
FLSASANPSE APPPSLLLAK MSLPSSSHAS QGAPSLGGLQ YSGGSLVQLL ESNGYGLKRS  300
FKSEREMLSV SQETGLTTDM NPEISSVVSN NDMGRQSFDS QEVPSISAGP LHIEESLWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-5431733171NAC domain-containing protein 19
4dul_A2e-5431733171NAC domain-containing protein 19
1ut7_B2e-5431733171NO APICAL MERISTEM PROTEIN
1ut7_A2e-5431733171NO APICAL MERISTEM PROTEIN
1ut4_B2e-5431733171NO APICAL MERISTEM PROTEIN
1ut4_A2e-5431733171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010937202.10.0PREDICTED: NAC domain-containing protein 100-like
RefseqXP_010937201.10.0PREDICTED: NAC domain-containing protein 100-like
RefseqXP_010937200.10.0PREDICTED: NAC domain-containing protein 100-like
RefseqXP_010937199.10.0PREDICTED: NAC domain-containing protein 100-like
RefseqXP_010937198.10.0PREDICTED: NAC domain-containing protein 100-like
RefseqXP_010937197.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-132NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0M3R8521e-162A0A0M3R852_MANES; NAC transcription factors 17
STRINGVIT_17s0000g06400.t011e-152(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.11e-121NAC domain containing protein 80